ACE2 Recombinant protein
Figure-1: SDS-PAGE analysis of purified ACE2 recombinant protein. 2 µg protein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.
Roll over image to zoom in
Shipping Info:
Order now and get it on Tuesday March 24, 2026
Same day delivery FREE on San Diego area orders placed by 1.00 PM
| Amount : | 50μg |
| Purification : | >95% by SDS-PAGE. |
| Content : | 0.5 mg/ml in 50 mM Tris, pH-7.4, 300 mM NaCl and 10% Glycerol |
| Storage condition : | ACE2 Protein is shipped on ice packs. Upon arrival, Store at -20°C. Do not freeze-thaw multiple times. |
| AA sequence : | MDEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIELEHHHHHH |
|
There are currently no product reviews
|













.png)









