BAFF R Recombinant Protein
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Purification : | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Content : | Lyophilized from a 0.2µm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. |
| Storage condition : | Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| AA sequence : | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG. |
| Alternative Name : | TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor. |
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|









.png)











