IL37 Recombinant Protein
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 25 µg |
| Purification : | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Content : | IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4. |
| Storage condition : | Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| AA sequence : | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD. |
| Alternative Name : | Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FI |
Source : Escherichia Coli. Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.The IL37 is purified by proprietary chromatographic techniques. Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 cytokine family. There are 5 alternatively spliced transcript variants encoding distinct isoforms with distinct expression profiles. The longest IL-1F7 transcript, named IL1F7b or IL1F7 isoform 1, encodes a 218 aa residues proprotein and containing a 45 aa propeptide which is cleaved to produce a mature protein. IL1F7b binds to IL18 Rb with low affinity however it doesn't exert any IL18 agonistic or antagonistic effects. IL1F7b also binds IL18BP (interleukin 18 binding protein), which is an inhibitory binding protein of interleukin 18 (IL18), and afterward forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18.
It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 µl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|










.png)






