Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
    • Custom Recombinant Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Cell Lines
  4. /
  5. Stable Cell Lines
  6. /
  7. mCD73 Stable Cell Line-H

mCD73 Stable Cell Line-H

Share:

Fig-1: Detection of mouse CD73 in the HEK293/mCD73 stable cell line by Flow Cytometry [Cell surface staining]. HEK293 cells (Green); HEK293/mCD73 cells (Red).

mCD73 Stable Cell Line-H

Roll over image to zoom in

   

Product code: 14-513ACL

Application : Functional Assay

Shipping Info:

Order now and get it on Wednesday December 06, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Local delivery areas

Same-day delivery in San Diego available for the following zip codes:

92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
Download TDS / Manual MSDS
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
1 Vial
$2,750.00  $2,200.00 

Bulk Order

Add to Wish List

Shipping Info:

Order now and get it on Wednesday December 06, 2023

Same day delivery FREE on San Diego area orders placed by 1.00 PM

Download TDS / Manual MSDS

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 1 Vial
Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Storage condition : Immediately upon receipt, store in liquid nitrogen.

mCD73 Stable Cell Line-H is a stably transfected HEK293 cell line which expresses mouse Cluster of Differentiation 73 (CD73 also known as ecto-5`-nucleotidase).

Sequence data: mCD73 (accession number NP_035981)

MRPAAAKVPKWLLLALSALLPQWPAASAWELTILHTNDVHSRLEQTSDDSTKCLNASLCV
GGVARLFTKVQQIRKEEPNVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNH
EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGYTS
KETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDI
VVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVPVVQAYAFGKYLGYLKVEFDDKG
NVITSYGNPILLNSSIPEDATIKADINQWRIKLDNYSTQELGRTIVYLDGSTQTCRFREC
NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDEKNNGTITWENLAAVLPFG
GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDINRKPWNRVVQLEVLCTK
CRVPIYEPLEMDKVYKVTLPSYLANGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVV
YPAVEGRIKFSAASHYQGSFPLVILSFWAMILILYQ
 
 

Application:.

  •  Screen for antibodies of mouse CD73 through Flow Cytometry. 

Culture conditions:

Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
 
It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
 
Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
 
To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
 
 
 

LIMITED USE RESTRICTIONS:

THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

By use of this product, user agrees to be bound by the terms of this limited use statement.

This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

 

 

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-2B4 antibody(DM70), Rabbit mAb

Anti-2B4 antibody(DM70), Rabbi...

details-Anti-2B4 antibody(DM70), Rabbit mAb
Anti-Human CD68 APC (Clone : Y1/82A)

Anti-Human CD68 APC (Clone : Y...

details-Anti-Human CD68 APC (Clone : Y1/82A)
Rabbit polyclonal antibody to SARS-CoV2 S-protein (ACE2 binding domain)

Rabbit polyclonal antibody to ...

details-Rabbit polyclonal antibody to SARS-CoV2 S-protein (ACE2 binding domain)
Anti-Human CD164 Antibody (Clone : 67D2)

Anti-Human CD164 Antibody (Clo...

details-Anti-Human CD164 Antibody (Clone : 67D2)
CTF1 Human

CTF1 Human

details-CTF1 Human
Anti-p16 Monoclonal Antibody (Clone:IHC116)-Ready to Use

Anti-p16 Monoclonal Antibody (...

details-Anti-p16 Monoclonal Antibody (Clone:IHC116)-Ready to Use
Anti-Human TCR gamma/delta PE-DyLight® 594 (Clone : B1)

Anti-Human TCR gamma/delta PE-...

details-Anti-Human TCR gamma/delta PE-DyLight® 594 (Clone : B1)
Anti-TAG-72 Monoclonal Antibody (Clone:IHC072)-Ready to Use

Anti-TAG-72 Monoclonal Antibod...

details-Anti-TAG-72 Monoclonal Antibody (Clone:IHC072)-Ready to Use
Anti-Human CD340 APC (Clone : 24D2)

Anti-Human CD340 APC (Clone : ...

details-Anti-Human CD340 APC (Clone : 24D2)
Recombinant human NKp30 protein with C-terminal human Fc

Recombinant human NKp30 protei...

details-Recombinant human NKp30 protein with C-terminal human Fc
Anti-Human IL 12/23 (Briakinumab) – Fc Muted™ HRP

Anti-Human IL 12/23 (Briakinum...

details-Anti-Human IL 12/23 (Briakinumab) – Fc Muted™ HRP
Monoclonal antibody to CD46 (Clone: TRA-2-10)

Monoclonal antibody to CD46 (C...

details-Monoclonal antibody to CD46 (Clone: TRA-2-10)
Anti-Human IL-6 (Sarilumab) – APC

Anti-Human IL-6 (Sarilumab) –...

details-Anti-Human IL-6 (Sarilumab) – APC
Monoclonal Antibody to SARS-CoV-2 nucleocapsid (Clone: ABM5H9.1A2)

Monoclonal Antibody to SARS-Co...

details-Monoclonal Antibody to SARS-CoV-2 nucleocapsid (Clone: ABM5H9.1A2)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
ACE2/HEK293 Stable Cell Line

ACE2/HEK293 Stable Cell Line

details-ACE2/HEK293 Stable Cell Line
TLR4/IL-8 Leeporter™ Luciferase Reporter-HeLa Cell Line

TLR4/IL-8 Leeporter™ Luciferase R...

details-TLR4/IL-8 Leeporter™ Luciferase Reporter-HeLa Cell Line
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Related Products

GPC3 Stable Cell Line-H

GPC3 Stable Cell Line-H

SIGLEC9 Stable Cell Line

SIGLEC9 Stable Cell Line

VEGFR2 Stable Cell Line-H

VEGFR2 Stable Cell Line-H

New Products

Recombinant Human YAP1 Protein, His Tag

Recombinant Human YAP1 Protein, His Tag

Recombinant Human IL-2 Superkine (Mutant, C-6His) Protein

Recombinant Human IL-2 Superkine (Mutant, C-6His) Protein

Recombinant Human ADAM9 Protein, hFc Tag

Recombinant Human ADAM9 Protein, hFc Tag

close

Please Login to write a Review !!


close

mCD73 Stable Cell Line-H

Product code: 14-513ACL
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development
  • Custom Recombinant Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart