Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. MIF (Active) Recombinant Protein

MIF (Active) Recombinant Protein

Share:

MIF (Active) Recombinant Protein

Roll over image to zoom in

   

Product code: 32-1597

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
25 µg
$363.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 25 µg
Purification : Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Content : MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Storage condition : Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
AA sequence : MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
Alternative Name : Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Source : Escherichia Coli. MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa. The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml. Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-HLA-ABCE PE (Clone : TP25.99SF)

Anti-HLA-ABCE PE (Clone : TP25...

details-Anti-HLA-ABCE PE (Clone : TP25.99SF)
Z-IE(OMe)TD(OMe)-FMK (Caspase 8 Inhibitor)

Z-IE(OMe)TD(OMe)-FMK (Caspase ...

details-Z-IE(OMe)TD(OMe)-FMK (Caspase 8 Inhibitor)
Rabbit Monoclonal Antibody to Bevacizumab/Avastin (Clone : 30E1)

Rabbit Monoclonal Antibody to ...

details-Rabbit Monoclonal Antibody to Bevacizumab/Avastin (Clone : 30E1)
Recombinant 2019-nCoV S Protein RBD-SD1 (C-mFC) (Active)

Recombinant 2019-nCoV S Protei...

details-Recombinant 2019-nCoV S Protein RBD-SD1 (C-mFC) (Active)
Recombinant 2019-nCoV S Protein RBD (L452R, Mammalian, C-His)

Recombinant 2019-nCoV S Protei...

details-Recombinant 2019-nCoV S Protein RBD (L452R, Mammalian, C-His)
Rat IgG2a Isotype Control PE Antibody (Clone : S193)

Rat IgG2a Isotype Control PE A...

details-Rat IgG2a Isotype Control PE Antibody (Clone : S193)
Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : SPM570)

Monoclonal Antibody to CD45 / ...

details-Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : SPM570)
Anti-Mouse CD106 Antibody (Clone : 429 (MVCAM.A))

Anti-Mouse CD106 Antibody (Clo...

details-Anti-Mouse CD106 Antibody (Clone : 429 (MVCAM.A))
Recombinant human EGF protein with C-terminal human Fc tag

Recombinant human EGF protein ...

details-Recombinant human EGF protein with C-terminal human Fc tag
Recombinant human Gastrin protein with C-terminal human Fc tag

Recombinant human Gastrin prot...

details-Recombinant human Gastrin protein with C-terminal human Fc tag
Anti-Human CTLA-4 (Ipilimumab) – Fc Muted™ Biotin

Anti-Human CTLA-4 (Ipilimumab)...

details-Anti-Human CTLA-4 (Ipilimumab) – Fc Muted™ Biotin
Recombinant Human Noggin/NOG (N-8His-Flag)(Discontinued)

Recombinant Human Noggin/NOG (...

details-Recombinant Human Noggin/NOG (N-8His-Flag)(Discontinued)
Mouse Monoclonal Antibody to IL-8 (Clone : 3D4C3)(Discontinued)

Mouse Monoclonal Antibody to I...

details-Mouse Monoclonal Antibody to IL-8 (Clone : 3D4C3)(Discontinued)
GCP-2 Recombinant Protein

GCP-2 Recombinant Protein

details-GCP-2 Recombinant Protein

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

Recombinant Mouse Interleukin-13/IL-13 (Pro22-Phe131,C-6His)(Discontinued)

Recombinant Mouse Interleukin-13/IL-13 (Pro22-Phe131,C-6His)(Discontinued)

Cyclophilin H, his Recombinant Protein

Cyclophilin H, his Recombinant Protein

DNAL1 Recombinant Protein

DNAL1 Recombinant Protein

New Products

Anti-CD325 PE Mab(8C11)

Anti-CD325 PE Mab(8C11)

Anti-CD134, Mouse (OX40) Monoclonal Antibody(Clone: OX-86) BSA/Azide Free

Anti-CD134, Mouse (OX40) Monoclonal Antibody(Clone: OX-86) BSA/Azide Free

Anti-CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) Monoclonal Antibody(Clone: CD40LG/2761) BSA/Azide Free

Anti-CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) Monoclonal Antibody(Clone: CD40LG/2761) BSA/Azide Free

close

Please Login to write a Review !!


close

MIF (Active) Recombinant Protein

Product code: 32-1597
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart