Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Cell Lines
    4. /
    5. Stable Cell Lines
    6. /
    7. NKp46 Stable Cell Line

    NKp46 Stable Cell Line

    Share:

    Fig-1: Detection of human NKp46 in the CHO-K1/NKp46 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/NKp46 cells (Red).

    NKp46 Stable Cell Line

    Roll over image to zoom in

       

    Product code: 14-512ACL

    Application : Functional Assay

    Shipping Info:

    Order now and get it on Tuesday July 05, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Local delivery areas

    Same-day delivery in San Diego available for the following zip codes:

    92121, 92122, 92037, 92117, 92109, 92110, 92101, 92010, 92011, 92009, 92008
    Download TDS / Manual MSDS
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price
    1 Vial
    $2,750.00 

    Add to Wish List

    Bulk Order

    Shipping Info:

    Order now and get it on Tuesday July 05, 2022

    Same day delivery FREE on San Diego area orders placed by 1.00 PM

    Download TDS / Manual MSDS

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 1 Vial
    Content : Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
    Storage condition : Immediately upon receipt, store in liquid nitrogen.

    NKp46 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human activating Natural Killer cell receptor 46 (NKp46, also known as Natural Cytotoxicity triggering Receptor 1 (NCR1) or CD335).

    Sequence data: hNKp46 (accession number NP_004820)

    MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
    HFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
    YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
    TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET
    GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN
    TQTL

     

    Application:.

    •  Screen for antibodies of human NKp46 through Flow Cytometry. 

    Culture conditions:

    Cells should be grown at 37oC with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS and 1% Pen/Strep, plus 10 µg/ml of Blasticidin.
     
    It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37oC water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37oC-CO2 incubator.
     
    Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence.
     
    To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
     
     
     

    LIMITED USE RESTRICTIONS:

    THIS PRODUCT IS SOLELY FOR IN VITRO RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE.

    By use of this product, user agrees to be bound by the terms of this limited use statement.

    This product is solely for Internal Research Purposes and not for Commercial Purposes. Commercial Purposes include, but are not limited to (1) use of the cell line in manufacturing; (2) use of the cell line to provide a service, information or data; (3) use of the cell line for therapeutic, diagnostic or prophylactic purposes; or (4) resale of the cell line whether or not such cell lines are resold for use in research. The buyer cannot sell, give or otherwise transfer this product to a third party.

    Commercial License Agreement is available for non-research use if applicable. Please contact Abeomics (info@abeomics.com).

     

     

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    ACE2 Antibody (Alexa Fluor 647 Conjugated)

    ACE2 Antibody (Alexa Fluor 647...

    details-ACE2 Antibody (Alexa Fluor 647 Conjugated)
    cGH Recombinant Protein

    cGH Recombinant Protein

    details-cGH Recombinant Protein
    Anti-Human DR5 (Drozitumab) – Fc Muted™ HRP

    Anti-Human DR5 (Drozitumab) –...

    details-Anti-Human DR5 (Drozitumab) – Fc Muted™ HRP
    Anti-TNFRSF10B Antibody (tigatuzumab biosimilar) (GEN-1029)

    Anti-TNFRSF10B Antibody (tigat...

    details-Anti-TNFRSF10B Antibody (tigatuzumab biosimilar) (GEN-1029)
    Anti-Human CD326 PE (Clone : 323/A3)

    Anti-Human CD326 PE (Clone : 3...

    details-Anti-Human CD326 PE (Clone : 323/A3)
    SARS Spike Protein (14-667)

    SARS Spike Protein (14-667)

    details-SARS Spike Protein (14-667)
    Recombinant 2019-nCoV S Protein RBD-SD1 (C-6His)

    Recombinant 2019-nCoV S Protei...

    details-Recombinant 2019-nCoV S Protein RBD-SD1 (C-6His)
    Anti-CD57 Monoclonal Antibody (Clone:IHC539)

    Anti-CD57 Monoclonal Antibody ...

    details-Anti-CD57 Monoclonal Antibody (Clone:IHC539)
    Anti-Basic Cytokeratins Monoclonal Antibody (Clone:AE3)

    Anti-Basic Cytokeratins Monocl...

    details-Anti-Basic Cytokeratins Monoclonal Antibody (Clone:AE3)
    Anti-Human CD8 PE (Clone : LT8)

    Anti-Human CD8 PE (Clone : LT8...

    details-Anti-Human CD8 PE (Clone : LT8)
    Coronavirus (COVID-19) Nucleocapsid Antibody

    Coronavirus (COVID-19) Nucleoc...

    details-Coronavirus (COVID-19) Nucleocapsid Antibody
    VEGF Mouse, Yeast

    VEGF Mouse, Yeast

    details-VEGF Mouse, Yeast
    Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : SPM496)

    Monoclonal Antibody to CD45 / ...

    details-Monoclonal Antibody to CD45 / LCA (Leucocyte Marker)(Clone : SPM496)
    Anti-CD15/Leu-M1 Monoclonal Antibody (Clone:IHC527)

    Anti-CD15/Leu-M1 Monoclonal An...

    details-Anti-CD15/Leu-M1 Monoclonal Antibody (Clone:IHC527)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    G alpha 15 Stable Cell Line-PAC1-CHO-K1-Human(Currently Unavailable)

    G alpha 15 Stable Cell Line-PAC1-CHO-K1-Human(Currently Unavailable)

    P2Y4 Stable Cell Line-1321N1-Human(Currently Unavailable)

    P2Y4 Stable Cell Line-1321N1-Human(Currently Unavailable)

    Gqi5 Stable Cell Line-CHO-K1-Human(Currently Unavailable)

    Gqi5 Stable Cell Line-CHO-K1-Human(Currently Unavailable)

    close

    Please Login to write a Review !!


    close

    NKp46 Stable Cell Line

    Product code: 14-512ACL
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart