ProNGF Recombinant Protein
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 10 µg |
| Purification : | Greater than 95.0% as determined by SDS-PAGE. |
| Content : | ProNGF was lyophilized from a 0.2µm filtered solution of 20mM PB and 250mM NaCl pH 7.2. |
| Storage condition : | Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| AA sequence : | MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA. |
| Alternative Name : | Human Pro-NGF, ProNGF, NGFB. |
Source : Escherichia Coli.
Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|












.png)











