Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDELEHHHHHH |
Source: E.coli.
MW :30.4kD.
Recombinant E.coli Methionine Aminopeptidase is produced by our E.coli expression system and the target gene encoding Ala2-Glu264 is expressed with a 6His tag at the C-terminus. Methionine Aminopeptidase (MAP) is a member of the peptidase M24A family. MAP is essential for cell growth because it plays a central role for protein maturation as it removes the initiator Met residue from newly synthesized proteins.
MW :30.4kD.
Recombinant E.coli Methionine Aminopeptidase is produced by our E.coli expression system and the target gene encoding Ala2-Glu264 is expressed with a 6His tag at the C-terminus. Methionine Aminopeptidase (MAP) is a member of the peptidase M24A family. MAP is essential for cell growth because it plays a central role for protein maturation as it removes the initiator Met residue from newly synthesized proteins.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 4262194. 34 interactions. |
|
There are currently no product reviews
|











.png)







