Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Hepatitis B Surface Antigen preS1

Recombinant Hepatitis B Surface Antigen preS1

Share:

Recombinant Hepatitis B Surface Antigen preS1

Roll over image to zoom in

   

Product code: 32-5530

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
50 µg
$363.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 50 µg
Purification : HBsAg Protein is >95% pure as determined by 10% PAGE (coomassie staining).
Content : HBsAg protein was lyophilized from 0.2µm filtered (1mg/ml) solution in 20mM PB, pH 7.4, and 50mM NaCl.
Storage condition : This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
AA sequence : MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA.

Source : The E.Coli derived Recombinant Hepatitis B Surface Antigen preS1 is a single non-glycosylated polypeptide chain containing 119 amino acids and having a molecular weight of 12.6 kDa. Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, LHBs has a 119 amino acid region called preS1.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

MMLV RT Recombinant Protein

MMLV RT Recombinant Protein

details-MMLV RT Recombinant Protein
Anti-CD81 Monoclonal Antibody (Clone:M38)

Anti-CD81 Monoclonal Antibody ...

details-Anti-CD81 Monoclonal Antibody (Clone:M38)
Anti-Annexin A1 Monoclonal Antibody (Clone:IHC512)

Anti-Annexin A1 Monoclonal Ant...

details-Anti-Annexin A1 Monoclonal Antibody (Clone:IHC512)
Anti-p27 Monoclonal Antibody (Clone:IHC027)

Anti-p27 Monoclonal Antibody (...

details-Anti-p27 Monoclonal Antibody (Clone:IHC027)
Recombinant human L5RA protein with C-terminal 6×His tag

Recombinant human L5RA protein...

details-Recombinant human L5RA protein with C-terminal 6×His tag
C1QTNF2 Recombinant Protein

C1QTNF2 Recombinant Protein

details-C1QTNF2 Recombinant Protein
Recombinant human FMNL1 protein with C-terminal human Fc tag

Recombinant human FMNL1 protei...

details-Recombinant human FMNL1 protein with C-terminal human Fc tag
Anti-CD27 Antibody (varlilumab biosimilar) (1F5)

Anti-CD27 Antibody (varlilumab...

details-Anti-CD27 Antibody (varlilumab biosimilar) (1F5)
Recombinant human RhoC protein with C-terminal human Fc tag

Recombinant human RhoC protein...

details-Recombinant human RhoC protein with C-terminal human Fc tag
Recombinant Human ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 1/CD38 (C-mFc)

Recombinant Human ADP-ribosyl ...

details-Recombinant Human ADP-ribosyl Cyclase/cyclic ADP-ribose Hydrolase 1/CD38 (C-mFc)
Recombinant human Myeloblastin protein with C-terminal human Fc tag

Recombinant human Myeloblastin...

details-Recombinant human Myeloblastin protein with C-terminal human Fc tag
Recombinant Human Tumor Susceptibility Gene 101

Recombinant Human Tumor Suscep...

details-Recombinant Human Tumor Susceptibility Gene 101
GFP/VERO Stable Cell Line

GFP/VERO Stable Cell Line

details-GFP/VERO Stable Cell Line
Anti-Mouse CD16/CD32 Antibody (Clone : 93)

Anti-Mouse CD16/CD32 Antibody ...

details-Anti-Mouse CD16/CD32 Antibody (Clone : 93)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

Recombinant Human/Mouse/Rat GDF-8/Myostatin

Recombinant Human/Mouse/Rat GDF-8/Myostatin

Recombinant Mouse SLAM Family Member 5/SLAMF5/CD84(C-6His)

Recombinant Mouse SLAM Family Member 5/SLAMF5/CD84(C-6His)

Recombinant Rat G-CSF(Discontinued)

Recombinant Rat G-CSF(Discontinued)

New Products

Anti-CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) Monoclonal Antibody(Clone: CD40LG/2761) BSA/Azide Free

Anti-CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) Monoclonal Antibody(Clone: CD40LG/2761) BSA/Azide Free

Anti-Hu CD173 PE Mab(MEM-195)

Anti-Hu CD173 PE Mab(MEM-195)

Anti-Hu CD156c PE Mab(11G2)

Anti-Hu CD156c PE Mab(11G2)

close

Please Login to write a Review !!


close

Recombinant Hepatitis B Surface Antigen preS1

Product code: 32-5530
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart