Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Hepatitis B Surface Antigen preS2

Recombinant Hepatitis B Surface Antigen preS2

Share:

Recombinant Hepatitis B Surface Antigen preS2

Roll over image to zoom in

   

Product code: 32-5531

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price
50 µg
$363.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 50 µg
Purification : HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining).
Content : HBsAg protein was lyophilized from 0.2µm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Storage condition : This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
AA sequence : MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.

Source : E.coli. The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique. Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Recombinant Human Transmembrane Protein 27

Recombinant Human Transmembran...

details-Recombinant Human Transmembrane Protein 27
Anti-Cytokeratin 7+17 Monoclonal Antibody (Clone:C-46)

Anti-Cytokeratin 7+17 Monoclon...

details-Anti-Cytokeratin 7+17 Monoclonal Antibody (Clone:C-46)
BCOADC-E2 Recombinant Protein

BCOADC-E2 Recombinant Protein

details-BCOADC-E2 Recombinant Protein
Anti-TACSTD2 / TROP2 (Epithelial Marker) Monoclonal Antibody(Clone: TACSTD2/2151)

Anti-TACSTD2 / TROP2 (Epitheli...

details-Anti-TACSTD2 / TROP2 (Epithelial Marker) Monoclonal Antibody(Clone: TACSTD2/2151)
Recombinant MPXV A29L Protein, C-term His (E. Coli)

Recombinant MPXV A29L Protein,...

details-Recombinant MPXV A29L Protein, C-term His (E. Coli)
Anti-SARS-CoV-2 Nucleocapsid antibody(DM38), Rabbit mAb

Anti-SARS-CoV-2 Nucleocapsid a...

details-Anti-SARS-CoV-2 Nucleocapsid antibody(DM38), Rabbit mAb
Coronavirus (COVID-19) Spike Antibody

Coronavirus (COVID-19) Spike A...

details-Coronavirus (COVID-19) Spike Antibody
Anti-Human OX40L (Oxelumab) – APC

Anti-Human OX40L (Oxelumab) –...

details-Anti-Human OX40L (Oxelumab) – APC
rMMP 9 Recombinant Protein

rMMP 9 Recombinant Protein

details-rMMP 9 Recombinant Protein
Recombinant E.Coli Superoxide Dismutase

Recombinant E.Coli Superoxide ...

details-Recombinant E.Coli Superoxide Dismutase
oLeptin tA PEG Recombinant Protein

oLeptin tA PEG Recombinant Pro...

details-oLeptin tA PEG Recombinant Protein
Mouse Monoclonal Antibody to Human DDX41 (Clone : 4F3E11)(Discontinued)

Mouse Monoclonal Antibody to H...

details-Mouse Monoclonal Antibody to Human DDX41 (Clone : 4F3E11)(Discontinued)
Recombinant human CD32 protein with C-terminal human Fc tag

Recombinant human CD32 protein...

details-Recombinant human CD32 protein with C-terminal human Fc tag
Anti-Human CD279 (PD-1) (Nivolumab) – Fc Muted™

Anti-Human CD279 (PD-1) (Nivol...

details-Anti-Human CD279 (PD-1) (Nivolumab) – Fc Muted™

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Recombinant Mouse Interleukin-6/IL-6

Recombinant Mouse Interleukin-6/IL-6

Lypressin

Lypressin

CRISP3 Recombinant Protein

CRISP3 Recombinant Protein

New Products

Recombinant Human GPRC5C Protein

Recombinant Human GPRC5C Protein

Recombinant Human KIF-binding protein(C-His)

Recombinant Human KIF-binding protein(C-His)

Anti-ADGRE2 antibody(DMC370), IgG1 Chimeric mAb

Anti-ADGRE2 antibody(DMC370), IgG1 Chimeric mAb

close

Please Login to write a Review !!


close

Recombinant Hepatitis B Surface Antigen preS2

Product code: 32-5531
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart