Recombinant Human Actin-Related Protein 8/ACTR8 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,1mM DTT,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MNHKVHHHHHHMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRIFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDGLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRERAAFVW |
Source: E. coli.
MW :38.1kD.
Recombinant Human Actin-Related Protein 8/ACTR8 is produced by our E.coli expression system and the target gene encoding Met1-Trp329 is expressed with a 6His tag at the N-terminus. Actin-Related Protein 8 (ACTR8) is a member of the Actin family. ACTR8 is the first example in actin family that was found to be associated with mitotic chromosomes. ACTR8 plays a vital role in the functional organization of mitotic chromosomes. This protein is a proposed core component of the chromatin remodeling INO80 complex that is involved in transcriptional regulation, DNA replication and probable DNA repair, and it is required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage.
MW :38.1kD.
Recombinant Human Actin-Related Protein 8/ACTR8 is produced by our E.coli expression system and the target gene encoding Met1-Trp329 is expressed with a 6His tag at the N-terminus. Actin-Related Protein 8 (ACTR8) is a member of the Actin family. ACTR8 is the first example in actin family that was found to be associated with mitotic chromosomes. ACTR8 plays a vital role in the functional organization of mitotic chromosomes. This protein is a proposed core component of the chromatin remodeling INO80 complex that is involved in transcriptional regulation, DNA replication and probable DNA repair, and it is required for the recruitment of INO80 (and probably the INO80 complex) to sites of DNA damage.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Chromosome |
| BioGrid: | 125062. 28 interactions. |
|
There are currently no product reviews
|









.png)








