Recombinant Human Adipocyte Adhesion Molecule/ASAM/CLMP/ACAM (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | THTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVDHHHHHH |
Source: Human Cells.
MW :25.38kD.
Recombinant Human Adipocyte Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Thr19-Met233 is expressed with a 6His tag at the C-terminus. Adipocyte Adhesion Molecule (ASAM) is a type I transmembrane protein and member of the CTX family within the immunoglobulin superfamily. ASAM may be involved in the cell-cell adhesion, play an important role in adipocyte differentiation and development of obesity. ASAM can be expressed in the skeletal, heart, colon, spleen, muscle, lung and kidney with high level, and in the peripheral blood leukocytes and liver with low level. The extracellular region of ASAM consists two potential N-linked glycosylation sites, and two immunoglobulin domains, one V-type and one C2-type.
MW :25.38kD.
Recombinant Human Adipocyte Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Thr19-Met233 is expressed with a 6His tag at the C-terminus. Adipocyte Adhesion Molecule (ASAM) is a type I transmembrane protein and member of the CTX family within the immunoglobulin superfamily. ASAM may be involved in the cell-cell adhesion, play an important role in adipocyte differentiation and development of obesity. ASAM can be expressed in the skeletal, heart, colon, spleen, muscle, lung and kidney with high level, and in the peripheral blood leukocytes and liver with low level. The extracellular region of ASAM consists two potential N-linked glycosylation sites, and two immunoglobulin domains, one V-type and one C2-type.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell junction, Cell membrane |
| Tissue Specificity: | Predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. Expressed at high levels in small intestine and placenta, at intermediate levels in the heart, skeletal muscle, colon, spleen, kidney and lung and at low levels in the liver and peripheral blood leukocytes. Highly abundant in the intestine during embryo and fetal development (at protein level). |
| BioGrid: | 122919. 8 interactions. |
|
There are currently no product reviews
|















.png)








