Recombinant Human AGER/RAGE (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAVDHHHHHH |
Source: Human Cells.
MW :35.2kD.
Recombinant Human AGER is produced by our Mammalian expression system and the target gene encoding Ala23-Ala344 is expressed with a 6His tag at the C-terminus. Advanced Glycosylation End Product-Specific Receptor (AGER) belongs to the immunoglobulin superfamily of cell surface molecules. It lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Besides AGEs, AGER is also able to bind other ligands which is thought to result in pro-inflammatory gene activation. It is known that AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes. Furthermore, it plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes.
MW :35.2kD.
Recombinant Human AGER is produced by our Mammalian expression system and the target gene encoding Ala23-Ala344 is expressed with a 6His tag at the C-terminus. Advanced Glycosylation End Product-Specific Receptor (AGER) belongs to the immunoglobulin superfamily of cell surface molecules. It lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Besides AGEs, AGER is also able to bind other ligands which is thought to result in pro-inflammatory gene activation. It is known that AGER serve as a mediator of both acute and chronic vascular inflammation in certain conditions such as atherosclerosis and in particular as a complication of diabetes. Furthermore, it plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Endothelial cells. |
| BioGrid: | 106685. 6 interactions. |
|
There are currently no product reviews
|
















.png)










