Recombinant Human Amphiregulin/AREG(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
Source: E. coli.
MW :11.4kD.
Recombinant Human Amphiregulin is produced by our E.coli expression system and the target gene encoding Ser101-Lys198 is expressed. Amphiregulin (AREG) is a single-pass membrane protein with 252 amino acids. AREG belongs to the amphiregulin family, which contains 1 EGF-like domain. AREG is expressed in a variety of tissues including ovary, placenta, lung, kidney, stomach, colon, and breast. It is related to Epidermal Growth Factor (EGF) and Transforming Growth Factor Alpha (TGF-alpha). As an EGF-related growth factor, AREG interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. AREG may also play a protective role in Bleomycin-Induced Pneumopathy.
MW :11.4kD.
Recombinant Human Amphiregulin is produced by our E.coli expression system and the target gene encoding Ser101-Lys198 is expressed. Amphiregulin (AREG) is a single-pass membrane protein with 252 amino acids. AREG belongs to the amphiregulin family, which contains 1 EGF-like domain. AREG is expressed in a variety of tissues including ovary, placenta, lung, kidney, stomach, colon, and breast. It is related to Epidermal Growth Factor (EGF) and Transforming Growth Factor Alpha (TGF-alpha). As an EGF-related growth factor, AREG interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. AREG may also play a protective role in Bleomycin-Induced Pneumopathy.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| BioGrid: | 106869. 11 interactions. |
|
There are currently no product reviews
|

















.png)












