Recombinant Human Apolipoprotein E/ApoE (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNHVDHHHHHH |
Source: Human Cells.
MW :35.3kD.
Recombinant Human Apolipoprotein E is produced by our Mammalian expression system and the target gene encoding Lys19-His317 is expressed with a 6His tag at the C-terminus. ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport .ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma .Apolipoprotein E combines with fats (lipids) in the body to form molecules called lipoproteins and Apolipoprotein E is a major component of a specific type of lipoprotein called very low-density lipoproteins (VLDLs).
MW :35.3kD.
Recombinant Human Apolipoprotein E is produced by our Mammalian expression system and the target gene encoding Lys19-His317 is expressed with a 6His tag at the C-terminus. ApoE, a glycoprotein, is a structural component of very low density lipoprotein (vLDL) synthesized by the liver and intestinally synthesized chylomicrons . ApoE is also a constituent of a subclass of high density of lipoproteins (HDL) involved in cholesterol transport .ApoE mediates high affinity binding of chylomicrons and vLDL particles to the LDL receptor, allowing for specific uptake of these particles by the liver, preventing the accumulation of cholesterol rich particles in the plasma .Apolipoprotein E combines with fats (lipids) in the body to form molecules called lipoproteins and Apolipoprotein E is a major component of a specific type of lipoprotein called very low-density lipoproteins (VLDLs).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | Phosphorylated by FAM20C in the extracellular medium. |
Tissue Specificity: | Occurs in all lipoprotein fractions in plasma. It constitutes 10-20% of very low density lipoproteins (VLDL) and 1-2% of high density lipoproteins (HDL). APOE is produced in most organs. Significant quantities are produced in liver, brain, spleen, lung, adrenal, ovary, kidney and muscle. |
BioGrid: | 106845. 63 interactions. |
There are currently no product reviews
|