Recombinant Human Basal Cell Adhesion Molecule/BCAM (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAHHHHHH |
Source: Human Cells.
MW :57kD.
Recombinant Human Basal Cell Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Glu32-Ala547 is expressed with a 6His tag at the C-terminus. Basal cell adhesion molecule (BCAM, CD239) is an immunoglobulin superfamily protein that arises from alternate splicing of the Lutheran blood group molecule (Lu). The ECD of human BCAM contains two Ig-like V-type domains and three Ig-like C2-type domains. It shares 73% aa sequence identity with the ECDs of mouse and rat BCAM. BCAM is widely expressed in epithelial and endothelial tissues including in the vasculature, kidney glomerulus, small intestine, colon, hair follicle outer root sheath, and basal keratinocytes of the skin during inflammation. BCAM is also expressed on vascular and visceral smooth muscle cells and at the neuromuscular junction of skeletal muscle. BCAM is upregulated on carcinomas, particularly ovarian, sarcomas, astrocytomas, and melanomas. It may mediate intracellular signaling. It cooperates with Integrins beta1 and aV beta3 as an adhesion receptor for Laminins which contain the a5 chain. The Lutheran isoform is aberrantly phosphorylated in erythroid disorders and can enhance Lamininmediated adhesion of erythrocytes to vascular endothelial cells.
MW :57kD.
Recombinant Human Basal Cell Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Glu32-Ala547 is expressed with a 6His tag at the C-terminus. Basal cell adhesion molecule (BCAM, CD239) is an immunoglobulin superfamily protein that arises from alternate splicing of the Lutheran blood group molecule (Lu). The ECD of human BCAM contains two Ig-like V-type domains and three Ig-like C2-type domains. It shares 73% aa sequence identity with the ECDs of mouse and rat BCAM. BCAM is widely expressed in epithelial and endothelial tissues including in the vasculature, kidney glomerulus, small intestine, colon, hair follicle outer root sheath, and basal keratinocytes of the skin during inflammation. BCAM is also expressed on vascular and visceral smooth muscle cells and at the neuromuscular junction of skeletal muscle. BCAM is upregulated on carcinomas, particularly ovarian, sarcomas, astrocytomas, and melanomas. It may mediate intracellular signaling. It cooperates with Integrins beta1 and aV beta3 as an adhesion receptor for Laminins which contain the a5 chain. The Lutheran isoform is aberrantly phosphorylated in erythroid disorders and can enhance Lamininmediated adhesion of erythrocytes to vascular endothelial cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Post transnational modification: | Epinephrine-stimulated phosphorylation of Ser-621 by PKA enhances adhesion to laminin. |
| Tissue Specificity: | Wide tissue distribution (highest in the pancreas and very low in brain). Closely associated with the basal layer of cells in epithelia and the endothelium of blood vessel walls. |
| BioGrid: | 110237. 23 interactions. |
|
There are currently no product reviews
|










.png)









