Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human beta-Casein/CSN2/CASB (N-6His)

Recombinant Human beta-Casein/CSN2/CASB (N-6His)

Share:

Fig-1: Recombinant Human beta-Casein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.

Recombinant Human  beta-Casein/CSN2/CASB (N-6His)

Roll over image to zoom in

   

Product code: 32-8321

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $319.00 

  • $573.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • Review   (0)
Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS with 5% trehalose,pH 7.4. Reconstitute with sterile water.
Storage condition : Lyophilized protein should be stored at -20°C for 12 months. Reconstituted protein solution can be stored at 4-7°C for 1 month. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
Gene : CSN2
Gene ID : 1447
Uniprot ID : P05814

Source: E. coli.
MW :24.3kD.
Recombinant Human beta-casein is produced by our E.coli expression system and the target gene encoding Glu26-Val226 is expressed with a 6His tag at the N-terminus. Beta-casein is a protein that in humans is encoded by the CSN2 gene.Beta-casein is a 226 amino acids protein that belongs to the beta-casein family.It is secreted in milk. Beta-casein palys important role in determination of the surface properties of the casein micelles.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-BCMA antibody(DM16), Rabbit mAb

Anti-BCMA antibody(DM16), Rabb...

details-Anti-BCMA antibody(DM16), Rabbit mAb
Anti-Human TNF alpha (Adalimumab) – Fc Muted™

Anti-Human TNF alpha (Adalimum...

details-Anti-Human TNF alpha (Adalimumab) – Fc Muted™
Recombinant human MR1 protein with C-terminal human Fc tag

Recombinant human MR1 protein ...

details-Recombinant human MR1 protein with C-terminal human Fc tag
mTECK Recombinant Protein

mTECK Recombinant Protein

details-mTECK Recombinant Protein
Monoclonal Antibody to Human/Mouse CD27 NALE™ Purified (Clone: LG.3A10)

Monoclonal Antibody to Human/M...

details-Monoclonal Antibody to Human/Mouse CD27 NALE™ Purified (Clone: LG.3A10)
Anti-Human HER-2 (Trastuzumab) – APC

Anti-Human HER-2 (Trastuzumab)...

details-Anti-Human HER-2 (Trastuzumab) – APC
Recombinant human SCGB2A2 protein with C-terminal human Fc tag

Recombinant human SCGB2A2 prot...

details-Recombinant human SCGB2A2 protein with C-terminal human Fc tag
bPlacental Lactogen Recombinant Protein

bPlacental Lactogen Recombinan...

details-bPlacental Lactogen Recombinant Protein
Anti-CS1 Antibody (elotuzumab biosimilar) (HuLuc63)

Anti-CS1 Antibody (elotuzumab ...

details-Anti-CS1 Antibody (elotuzumab biosimilar) (HuLuc63)
Z-D(OMe)E(OMe)VD(OMe)-FMK (Caspase 3, 7 Inhibitor)

Z-D(OMe)E(OMe)VD(OMe)-FMK (Cas...

details-Z-D(OMe)E(OMe)VD(OMe)-FMK (Caspase 3, 7 Inhibitor)
Mouse Monoclonal Antibody to p53 (Clone : 5H7B9)(Discontinued)

Mouse Monoclonal Antibody to p...

details-Mouse Monoclonal Antibody to p53 (Clone : 5H7B9)(Discontinued)
Goat Polyclonal Antibody to Trx-tag(Discontinued)

Goat Polyclonal Antibody to Tr...

details-Goat Polyclonal Antibody to Trx-tag(Discontinued)
Mouse IgG3 Isotype Control DyLight<sup>®</sup> 488 (Clone : PPV-07)

Mouse IgG3 Isotype Control DyL...

details-Mouse IgG3 Isotype Control DyLight<sup>®</sup> 488 (Clone : PPV-07)
Mouse Monoclonal Antibody to IL-8 (Clone : 2A11D8)(Discontinued)

Mouse Monoclonal Antibody to I...

details-Mouse Monoclonal Antibody to IL-8 (Clone : 2A11D8)(Discontinued)

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin

Related Products

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-GST)

Recombinant Human Cytotoxic T-lymphocyte Protein 4 (C-GST)

Recombinant Human Thrombin

Recombinant Human Thrombin

mSHH, His Recombinant Protein

mSHH, His Recombinant Protein

New Products

Recombinant Human BTLA (C-mFc)

Recombinant Human BTLA (C-mFc)

Anti-Hu TROP2 APC

Anti-Hu TROP2 APC

Recombinant Human NF1-A(C-His)

Recombinant Human NF1-A(C-His)

close

Please Login to write a Review !!


close

Recombinant Human beta-Casein/CSN2/CASB (N-6His)

Product code: 32-8321
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart