Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Human beta-Casein/CSN2/CASB (N-6His)

    Recombinant Human beta-Casein/CSN2/CASB (N-6His)

    Share:

    Fig-1: Recombinant Human beta-Casein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.

    Recombinant Human  beta-Casein/CSN2/CASB (N-6His)

    Roll over image to zoom in

       

    Product code: 32-8321

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   10 µg

    •  50 µg

    • $319.00 

    • $573.00  $458.40 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • Review   (0)
    Amount : 50 µg
    Content : Lyophilized from a 0.2 µm filtered solution of PBS with 5% trehalose,pH 7.4. Reconstitute with sterile water.
    Storage condition : Lyophilized protein should be stored at -20°C for 12 months. Reconstituted protein solution can be stored at 4-7°C for 1 month. Aliquots of reconstituted samples are stable at -20°C for 3 months.
    AA sequence : MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
    Gene : CSN2
    Gene ID : 1447
    Uniprot ID : P05814

    Source: E. coli.
    MW :24.3kD.
    Recombinant Human beta-casein is produced by our E.coli expression system and the target gene encoding Glu26-Val226 is expressed with a 6His tag at the N-terminus. Beta-casein is a protein that in humans is encoded by the CSN2 gene.Beta-casein is a 226 amino acids protein that belongs to the beta-casein family.It is secreted in milk. Beta-casein palys important role in determination of the surface properties of the casein micelles.

    Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Anti-Human IL-6 (Sarilumab) – Fc Muted™

    Anti-Human IL-6 (Sarilumab) –...

    details-Anti-Human IL-6 (Sarilumab) – Fc Muted™
    Polyclonal Antibody to EGFR (Ab-1197)

    Polyclonal Antibody to EGFR (A...

    details-Polyclonal Antibody to EGFR (Ab-1197)
    Anti-TIM3 Monoclonal Antibody (Clone:IHC003)-Ready to Use

    Anti-TIM3 Monoclonal Antibody ...

    details-Anti-TIM3 Monoclonal Antibody (Clone:IHC003)-Ready to Use
    Anti-CD4 Monoclonal Antibody (Clone:MEM-241)-FITC Conjugated

    Anti-CD4 Monoclonal Antibody (...

    details-Anti-CD4 Monoclonal Antibody (Clone:MEM-241)-FITC Conjugated
    Anti-Human TNF alpha (Adalimumab) – Fc Muted™ HRP

    Anti-Human TNF alpha (Adalimum...

    details-Anti-Human TNF alpha (Adalimumab) – Fc Muted™ HRP
    Anti-Campylobacter jejuni Monoclonal Antibody(Clone: 2E-10)

    Anti-Campylobacter jejuni Mono...

    details-Anti-Campylobacter jejuni Monoclonal Antibody(Clone: 2E-10)
    Goat Polyclonal Antibody to Trx-tag(Discontinued)

    Goat Polyclonal Antibody to Tr...

    details-Goat Polyclonal Antibody to Trx-tag(Discontinued)
    Anti-Estrogen Receptor Monoclonal Antibody (Clone:IHC403)

    Anti-Estrogen Receptor Monoclo...

    details-Anti-Estrogen Receptor Monoclonal Antibody (Clone:IHC403)
    Anti-Nerve Growth Factor Receptor (NGFR) Monoclonal Antibody (Clone:IHC637)-Ready to Use

    Anti-Nerve Growth Factor Recep...

    details-Anti-Nerve Growth Factor Receptor (NGFR) Monoclonal Antibody (Clone:IHC637)-Ready to Use
    Anti-CD22 antibody(DM14), Rabbit mAb

    Anti-CD22 antibody(DM14), Rabb...

    details-Anti-CD22 antibody(DM14), Rabbit mAb
    Anti-IL2RA Antibody (basiliximab biosimilar) (CHI621)

    Anti-IL2RA Antibody (basilixim...

    details-Anti-IL2RA Antibody (basiliximab biosimilar) (CHI621)
    Mouse Monoclonal Antibody to IL-8 (Clone : 2A11D8)(Discontinued)

    Mouse Monoclonal Antibody to I...

    details-Mouse Monoclonal Antibody to IL-8 (Clone : 2A11D8)(Discontinued)
    Recombinant Human Hepatitis A Virus Cellular Receptor 1

    Recombinant Human Hepatitis A ...

    details-Recombinant Human Hepatitis A Virus Cellular Receptor 1
    Anti-p16 Monoclonal Antibody (Clone:IHC116)

    Anti-p16 Monoclonal Antibody (...

    details-Anti-p16 Monoclonal Antibody (Clone:IHC116)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Recombinant Human IL-12 Receptor Subunit  beta1/IL-12RB1/CD212 (C-Fc)

    Recombinant Human IL-12 Receptor Subunit beta1/IL-12RB1/CD212 (C-Fc)

    IL12 His Recombinant Protein

    IL12 His Recombinant Protein

    Recombinant Human Prion Protein 2

    Recombinant Human Prion Protein 2

    close

    Please Login to write a Review !!


    close

    Recombinant Human beta-Casein/CSN2/CASB (N-6His)

    Product code: 32-8321
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart