Recombinant Human beta-Casein/CSN2/CASB (N-6His)(Discontinued)
Fig-1: Recombinant Human beta-Casein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS with 5% trehalose,pH 7.4. Reconstitute with sterile water. |
| Storage condition : | Lyophilized protein should be stored at -20°C for 12 months. Reconstituted protein solution can be stored at 4-7°C for 1 month. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV |
Source: E. coli.
MW :24.3kD.
Recombinant Human beta-casein is produced by our E.coli expression system and the target gene encoding Glu26-Val226 is expressed with a 6His tag at the N-terminus. Beta-casein is a protein that in humans is encoded by the CSN2 gene.Beta-casein is a 226 amino acids protein that belongs to the beta-casein family.It is secreted in milk. Beta-casein palys important role in determination of the surface properties of the casein micelles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|

















.png)








