Recombinant Human beta-Defensin 1/DEFB1
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 130mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Source: E.coli.
MW :5.07kD.
Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed. beta-Defensin 1 (DEFB1) is a member of the beta-defensin family, which is highly expressed by epithelial cells. beta-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. beta-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in beta-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. beta-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, beta-defensin 1 is associated with induction profiles in gingival keratinocytes.
MW :5.07kD.
Recombinant Human beta-Defensin 1 is produced by our E.coli expression system and the target gene encoding Gly22-Lys68 is expressed. beta-Defensin 1 (DEFB1) is a member of the beta-defensin family, which is highly expressed by epithelial cells. beta-defensins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal peptide. beta-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. beta-defensin 1 is an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. Defects in beta-Defensin-1 contribute to asthma diagnosis, with apparent gender-specific effects in human. beta-defensin 1 may also play a role in the pathogenesis of severe sepsis. In addition, beta-defensin 1 is associated with induction profiles in gingival keratinocytes.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Membrane |
| Tissue Specificity: | Blood plasma. Sperm. Highly expressed in the lower head and midpiece of sperm. Significantly reduced levels found in the sperms of asthenozoospermia and leukocytospermia patients (at protein level). |
| BioGrid: | 108036. 9 interactions. |
|
There are currently no product reviews
|










.png)











