Recombinant Human beta-Nerve Growth Factor/ beta-NGF (Ser122-Arg239, Human Cells)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 250mM NaCl, pH 7.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR |
Source: Human Cells.
MW :13.5kD.
Recombinant Human beta-Nerve Growth Factor is produced by our Mammalian expression system and the target gene encoding Ser122-Arg239 is expressed. Human beta -Nerve Growth Factor ( beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha , beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
MW :13.5kD.
Recombinant Human beta-Nerve Growth Factor is produced by our Mammalian expression system and the target gene encoding Ser122-Arg239 is expressed. Human beta -Nerve Growth Factor ( beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha , beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 110869. 6 interactions. |
|
There are currently no product reviews
|














.png)









