Recombinant Human Bone Morphogenetic Protein 7(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 4mM HCl. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
Source: Human Cells.
MW :15.7kD.
Recombinant Human Bone Morphogenetic Protein 7 is produced by our Mammalian expression system and the target gene encoding Ser293-His431 is expressed. Bone morphogenetic protein 7 (BMP-7) is a widely expressed TGF- beta superfamily member with important functions during embryogenesis, in the adult, and in disease. The BMP-7 propeptide is cleaved intracellularly but remains in association with the growth factor domain. BMP-7 is subsequently secreted as a tetramer that consists of two propeptides and two disulfide-linked growth factor domains. Mature BMP-7 can also form disulfide-linked heterodimers with BMP-2 or BMP-4, complexes that show increased potency and range of activity compared to BMP-7 homodimers. BMP-7 exerts its biological effects through the type 2 receptors Activin RIIA, Activin RIIB, and BMPR-II and the type 1 receptors Activin RIA, BMPR-IA, and BMPR-IB. BMP-7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development, inhibits the branching of prostate epithelium, and antagonizes epithelial-mesenchymal transition (EMT). In pathological conditions, BMP-7 inhibits tumor growth and metastasis, ameliorates fibrotic damage in nephritis, and promotes neuroregeneration following brain ischemia.
MW :15.7kD.
Recombinant Human Bone Morphogenetic Protein 7 is produced by our Mammalian expression system and the target gene encoding Ser293-His431 is expressed. Bone morphogenetic protein 7 (BMP-7) is a widely expressed TGF- beta superfamily member with important functions during embryogenesis, in the adult, and in disease. The BMP-7 propeptide is cleaved intracellularly but remains in association with the growth factor domain. BMP-7 is subsequently secreted as a tetramer that consists of two propeptides and two disulfide-linked growth factor domains. Mature BMP-7 can also form disulfide-linked heterodimers with BMP-2 or BMP-4, complexes that show increased potency and range of activity compared to BMP-7 homodimers. BMP-7 exerts its biological effects through the type 2 receptors Activin RIIA, Activin RIIB, and BMPR-II and the type 1 receptors Activin RIA, BMPR-IA, and BMPR-IB. BMP-7 plays a role in a variety of organ systems. It promotes new bone formation and nephron development, inhibits the branching of prostate epithelium, and antagonizes epithelial-mesenchymal transition (EMT). In pathological conditions, BMP-7 inhibits tumor growth and metastasis, ameliorates fibrotic damage in nephritis, and promotes neuroregeneration following brain ischemia.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Several N-termini starting at positions 293, 300, 315 and 316 have been identified by direct sequencing resulting in secretion of different mature forms. |
| Tissue Specificity: | Expressed in the kidney and bladder. Lower levels seen in the brain. |
| BioGrid: | 107123. 53 interactions. |
|
There are currently no product reviews
|


















.png)










