Recombinant Human C-C motif chemokine 17/CCL17 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSVDHHHHHH |
Source: Human Cells.
MW :9.1kD.
Recombinant Human C-C motif chemokine 17 is produced by our Mammalian expression system and the target gene encoding Ala24ÂSer94 is expressed with a 6His tag at the C-terminus. C-C motif chemokine 17 (CCL17) is a novel CC chemokine, it belongs to the intercrine beta (chemokine CC) family. CCL17 is expressed at high levels in thymus, and at a lower level in lung, colon, and small intestine. CCL17 is also transiently expressed in stimulated peripheral blood mononuclear cells. Among CC chemokine family members, CCL17 has approximately 24 - 29% amino acid sequence identity with RANTES, MIP-1 alpha, MIP-1 beta, MCP-1, MCP-2 and MCP-3. CCL17 has been identified to be Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. CCL17 plays a role in T-cell development in thymus and in trafficking and activation of mature T-cells.
MW :9.1kD.
Recombinant Human C-C motif chemokine 17 is produced by our Mammalian expression system and the target gene encoding Ala24ÂSer94 is expressed with a 6His tag at the C-terminus. C-C motif chemokine 17 (CCL17) is a novel CC chemokine, it belongs to the intercrine beta (chemokine CC) family. CCL17 is expressed at high levels in thymus, and at a lower level in lung, colon, and small intestine. CCL17 is also transiently expressed in stimulated peripheral blood mononuclear cells. Among CC chemokine family members, CCL17 has approximately 24 - 29% amino acid sequence identity with RANTES, MIP-1 alpha, MIP-1 beta, MCP-1, MCP-2 and MCP-3. CCL17 has been identified to be Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. CCL17 plays a role in T-cell development in thymus and in trafficking and activation of mature T-cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed at high levels in thymus and at low levels in the lung, colon and small intestine. |
| BioGrid: | 112264. 6 interactions. |
|
There are currently no product reviews
|

















.png)










