Recombinant Human CD55/DAF (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSVDHHHHHH |
Source: Human Cells.
MW :36kD.
Recombinant Human CD55 is produced by our Mammalian expression system and the target gene encoding Asp35-Ser353 is expressed with a 6His tag at the C-terminus. CD55 is a member of the RCA (regulators of complement activation) family. RCA proteins is characterized by the presence of four to 30 SCRs (short consensus repeats also called CCPs for control protein modules) in their plasmaexposed regions. CD55 containing four SCR modules is involved in the regulation of the complement cascade. CD55 is known to bind CD97 via the first SCR. It also binds physiologically generated C3 convertases with its second and third SCRs. Binding results in an accelerated “decay”, or dissociation of active C3 convertases, thus blocking the development of C’ attack complexes on nonforeign cells. It is known that viruses and bacteria also utilize multiple SCR sites for infection.
MW :36kD.
Recombinant Human CD55 is produced by our Mammalian expression system and the target gene encoding Asp35-Ser353 is expressed with a 6His tag at the C-terminus. CD55 is a member of the RCA (regulators of complement activation) family. RCA proteins is characterized by the presence of four to 30 SCRs (short consensus repeats also called CCPs for control protein modules) in their plasmaexposed regions. CD55 containing four SCR modules is involved in the regulation of the complement cascade. CD55 is known to bind CD97 via the first SCR. It also binds physiologically generated C3 convertases with its second and third SCRs. Binding results in an accelerated “decay”, or dissociation of active C3 convertases, thus blocking the development of C’ attack complexes on nonforeign cells. It is known that viruses and bacteria also utilize multiple SCR sites for infection.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | The Ser/Thr-rich domain is heavily O-glycosylated. |
| Tissue Specificity: | Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix. |
| BioGrid: | 107974. 28 interactions. |
|
There are currently no product reviews
|
















.png)










