Recombinant Human CEACAM8/CD66b (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHVDHHHHHH |
Source: Human Cells.
MW :13.03kD.
Recombinant Human CEACAM8 is produced by our Mammalian expression system and the target gene encoding Gln35-His141 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) is a single chain, GPI-anchored, highly glycosylated protein which belongs to the immunoglobulin superfamily and the carcinoembryonic antigen(CEA) family. CEACAM8 is expressed by neutrophils and eosinophils, and serves as a binding partner for CEACAM-6 and Galectin-3. It contains two Ig-like C2-type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. Mature human CEACAM8 is a 287 amino acid GPI-linked glycoprotein. CEACAM family members are a set of widely expressed proteins involved in several biological functions, including cell adhesion, migration, signal transduction, and the regulation of gene expression. Abnormal overexpression and downregulation of some CEACAMs have been described in tumor cells.
MW :13.03kD.
Recombinant Human CEACAM8 is produced by our Mammalian expression system and the target gene encoding Gln35-His141 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) is a single chain, GPI-anchored, highly glycosylated protein which belongs to the immunoglobulin superfamily and the carcinoembryonic antigen(CEA) family. CEACAM8 is expressed by neutrophils and eosinophils, and serves as a binding partner for CEACAM-6 and Galectin-3. It contains two Ig-like C2-type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. Mature human CEACAM8 is a 287 amino acid GPI-linked glycoprotein. CEACAM family members are a set of widely expressed proteins involved in several biological functions, including cell adhesion, migration, signal transduction, and the regulation of gene expression. Abnormal overexpression and downregulation of some CEACAMs have been described in tumor cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow. |
| BioGrid: | 107514. 3 interactions. |
|
There are currently no product reviews
|












.png)











