Recombinant Human Creatine Kinase, Muscle/CKMM (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKVDHHHHHH |
Source: Human Cells.
MW :44.1kD.
Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus. Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
MW :44.1kD.
Recombinant Human CKMM is produced by our Mammalian expression system and the target gene encoding Met1-Lys381 is expressed with a 6His tag at the C-terminus. Creatine kinase M-type is also known as Creatine kinase M chain,M-CK. It is a protein that in humans is encoded by the CKM gene. It belongs to the ATP:guanido phosphotransferase family,containing 1 phosphagen kinase C-terminal domain and 1 phosphagen kinase N-terminal domain. Creatine kinase M-type can reversibly catalyzes the transfer of phosphate between ATP and various phosphogens. It plays a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| BioGrid: | 107578. 28 interactions. |
|
There are currently no product reviews
|















.png)








