Recombinant Human Cryptic Protein (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGVDHHHHHH |
Source: Human Cells.
MW :19.9kD.
Recombinant Human Cryptic is produced by our Mammalian expression system and the target gene encoding Met1-Gly169 is expressed with a 6His tag at the C-terminus. Cryptic (CFC1) is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. It contains an EGF-like domain, and is glycosylated on its N-terminal during post-translational modification. Cryptic is identified as a NODAL coreceptor involved in the correct establishment of the left-right axis. It may play a role in mesoderm and/or neural patterning during gastrulation. The unnormal expression of this gene may causes a series of diseases such as HTX2, Transposition of the great arteries dextro-looped 2, and Conotruncal heart malformations.
MW :19.9kD.
Recombinant Human Cryptic is produced by our Mammalian expression system and the target gene encoding Met1-Gly169 is expressed with a 6His tag at the C-terminus. Cryptic (CFC1) is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. It contains an EGF-like domain, and is glycosylated on its N-terminal during post-translational modification. Cryptic is identified as a NODAL coreceptor involved in the correct establishment of the left-right axis. It may play a role in mesoderm and/or neural patterning during gastrulation. The unnormal expression of this gene may causes a series of diseases such as HTX2, Transposition of the great arteries dextro-looped 2, and Conotruncal heart malformations.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Secreted |
| Post transnational modification: | N-glycosylated. |
| BioGrid: | 121022. 1 interactions. |
|
There are currently no product reviews
|










.png)









