Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1/CDK2AP1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARSVDHHHHHH |
Source: Human Cells.
MW :13.4kD.
Recombinant Human CDK2AP1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser115 is expressed with a 6His tag at the C-terminus. Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) is a member of the CDK2AP family. The homodimeric structure of CDK2AP1 includes an intrinsically disordered 60-residue N-terminal region and a four-helix bundle dimeric structure with reduced Cys-105 in the C-terminal region. The widely expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G(1)-to-S phase transition. In addition, CDK2AP1 serves as a regulatory role in DNA replication during S phase of the cell cycle.
MW :13.4kD.
Recombinant Human CDK2AP1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser115 is expressed with a 6His tag at the C-terminus. Cyclin-Dependent Kinase 2-Associated Protein 1 (CDK2AP1) is a member of the CDK2AP family. The homodimeric structure of CDK2AP1 includes an intrinsically disordered 60-residue N-terminal region and a four-helix bundle dimeric structure with reduced Cys-105 in the C-terminal region. The widely expressed CDK2AP1 protein is the only known specific inhibitor of CDK2, making it an important component of cell cycle regulation during G(1)-to-S phase transition. In addition, CDK2AP1 serves as a regulatory role in DNA replication during S phase of the cell cycle.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | Phosphorylated in vitro by IKBKE at Ser-46. |
| BioGrid: | 113770. 59 interactions. |
|
There are currently no product reviews
|
















.png)










