Recombinant Human Cyclin-Dependent Kinase 4/CDK4 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Source: E. coli.
MW :37.2kD.
Recombinant Human Cyclin-Dependent Kinase 4 is produced by our E.coli expression system and the target gene encoding Met1-Glu303 is expressed with a 6His, T7 tag at the N-terminus. Cyclin-Dependent Kinase 4 (CDK4) is a member of the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. CDK4 is a component of Cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G1/S transition. These complexes are major integrators of various mitogenenic and antimitogenic signals. It is shown that CDK4 is responsible for the phosphorylation of retinoblastoma gene product (Rb). Defects in CDK4 are a cause of susceptibility to cutaneous Malignant Melanoma Type 3.
MW :37.2kD.
Recombinant Human Cyclin-Dependent Kinase 4 is produced by our E.coli expression system and the target gene encoding Met1-Glu303 is expressed with a 6His, T7 tag at the N-terminus. Cyclin-Dependent Kinase 4 (CDK4) is a member of the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. CDK4 is a component of Cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G1/S transition. These complexes are major integrators of various mitogenenic and antimitogenic signals. It is shown that CDK4 is responsible for the phosphorylation of retinoblastoma gene product (Rb). Defects in CDK4 are a cause of susceptibility to cutaneous Malignant Melanoma Type 3.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Membrane |
| Post transnational modification: | Phosphorylation at Thr-172 is required for enzymatic activity. Phosphorylated, in vitro, at this site by CCNH-CDK7, but, in vivo, appears to be phosphorylated by a proline-directed kinase. In the cyclin D-CDK4-CDKN1B complex, this phosphorylation and consequent CDK4 enzyme activity, is dependent on the tyrosine phosphorylation state of CDKN1B. Thus, in proliferating cells, CDK4 within the complex is phosphorylated on Thr-172 in the T-loop. In resting cells, phosphorylation on Thr-172 is prevented by the non-tyrosine-phosphorylated form of CDKN1B. |
| BioGrid: | 107454. 208 interactions. |
|
There are currently no product reviews
|











.png)







