Recombinant Human Cyclin-Dependent Kinase 6/CDK6 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mM Tris, 100mM NaCl, 20% Glycerol, 5mM DTT, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA |
Source: E.coli.
MW :39.1kD.
Recombinant Human Cyclin-Dependent Kinase 6 is produced by our E.coli expression system and the target gene encoding Met1-Ala326 is expressed with a 6His tag at the N-terminus. Cyclin-Dependent Kinase 6 (CDK6 belongs to the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. CDK6 is expressed in many tissues and contains one protein kinase domain. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. Mutations and overexpression of CDK6, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis.
MW :39.1kD.
Recombinant Human Cyclin-Dependent Kinase 6 is produced by our E.coli expression system and the target gene encoding Met1-Ala326 is expressed with a 6His tag at the N-terminus. Cyclin-Dependent Kinase 6 (CDK6 belongs to the CMGC Ser/Thr protein kinase family and CDC2/CDKX subfamily. CDK6 is expressed in many tissues and contains one protein kinase domain. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. Mutations and overexpression of CDK6, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Cell projection, Cytoplasm |
| Post transnational modification: | Thr-177 phosphorylation and Tyr-24 dephosphorylation promotes kinase activity. |
| Tissue Specificity: | Expressed ubiquitously. Accumulates in squamous cell carcinomas, proliferating hematopoietic progenitor cells, beta-cells of pancreatic islets of Langerhans, and neuroblastomas. Reduced levels in differentiating cells. |
| BioGrid: | 107456. 162 interactions. |
|
There are currently no product reviews
|















.png)











