Recombinant Human DCBLD2/ESDN (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVAVDHHHHHH |
Source: Human Cells.
MW :52.2kD.
Recombinant Human DCBLD2 is produced by our Mammalian expression system and the target gene encoding Gln67-Ala528 is expressed with a 6His tag at the C-terminus. Discoidin, CUB and LCCL domain-containing protein 2(DCBLD2) is a protein contains 1 CUB domain, 1 F5/8 type C domain, 1 LCCL domain. DCBLD2 is Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. Model organisms have been used in the study of DCBLD2 function. Male and female animals underwent a standardized phenotypic screen to determine the effects of deletion. Additional screens performed: In-depth immunological phenotyping.
MW :52.2kD.
Recombinant Human DCBLD2 is produced by our Mammalian expression system and the target gene encoding Gln67-Ala528 is expressed with a 6His tag at the C-terminus. Discoidin, CUB and LCCL domain-containing protein 2(DCBLD2) is a protein contains 1 CUB domain, 1 F5/8 type C domain, 1 LCCL domain. DCBLD2 is Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. Model organisms have been used in the study of DCBLD2 function. Male and female animals underwent a standardized phenotypic screen to determine the effects of deletion. Additional screens performed: In-depth immunological phenotyping.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. |
| BioGrid: | 126285. 15 interactions. |
|
There are currently no product reviews
|










.png)







