Recombinant Human DCN1-Like Protein 1/DCUN1D1 (N-6His)

Product code: 32-7249

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $420.00 

  • $699.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MGSSHHHHHHSSGLVPRGSHMNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
Gene : DCUN1D1
Gene ID : 54165
Uniprot ID : Q96GG9
Source: E.coli.
MW :32.3kD.
Recombinant Human DCN1-Like Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Val259 is expressed with a 6His tag at the N-terminus. DCN1-Like Protein 1 is a protein containing 1 DCUN1 domain and 1 UBA-like domain. DCN1-Like Protein 1 contains part of an E3 Ubiquitin Ligase Complex for Neddylation. It is required for Neddylation of Cullin components of E3 Cullin-RING Ubiquitin Ligase complexes. It enhances the rate of Cullins Neddylation. DCN1-Like Protein 1 recruits the NEDD8-charged E2 Enzyme to the Cullin component. DCUN1D1 is involved in the release of inhibitory effects of CAND1 on the Cullin-RING Ligase E3 complex assembly and activity. It acts also as an oncogene facilitating malignant transformation and carcinogenic progression.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Nucleus
Tissue Specificity: Expressed in pancreas, kidney, placenta, brain and heart. Weakly or not expressed in liver, skeletal muscle and lung. Strongly overexpressed in thyroid tumors, bronchioloalveolar carcinomas, and malignant tissues of squamous cell carcinoma of the oral tongue. Not overexpressed in aggressive adrenocortical carcinomas.
BioGrid: 119920. 237 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products