Recombinant Human Delta-like Protein 3/DLL3 (N-8His-Flag)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHHHDYKDDDDKAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR |
Source: Human Cells.
MW :50.3kD.
Recombinant Human Delta-like Protein 3 is produced by our expression system and the target gene encoding Ala27-Arg490 is expressed Delta-like protein 3 (DLL3) a member of the delta protein ligand family and inhibits primary neurogenesis. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mature human DLL1 consists of a 466 amino acid (aa) extracellular domain (ECD) with one DSL domain and six EGF-like repeats, a 21 aa transmembrane segment, and a 105 aa cytoplasmic domain. It plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. DLL3 binds and activates Notch-1. Defects in DLL3 are the cause of spondylocostal dysostosis type 1 (SCDO1). Expression of DLL3 is highest in fetal brain. It plays a key role in somitogenesis within the Paraxial mesoderm.
MW :50.3kD.
Recombinant Human Delta-like Protein 3 is produced by our expression system and the target gene encoding Ala27-Arg490 is expressed Delta-like protein 3 (DLL3) a member of the delta protein ligand family and inhibits primary neurogenesis. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mature human DLL1 consists of a 466 amino acid (aa) extracellular domain (ECD) with one DSL domain and six EGF-like repeats, a 21 aa transmembrane segment, and a 105 aa cytoplasmic domain. It plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm. DLL3 binds and activates Notch-1. Defects in DLL3 are the cause of spondylocostal dysostosis type 1 (SCDO1). Expression of DLL3 is highest in fetal brain. It plays a key role in somitogenesis within the Paraxial mesoderm.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Post transnational modification: | Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation. |
|
There are currently no product reviews
|















.png)











