Recombinant Human E3 Ubiquitin-Protein Ligase ZNRF1 (N, C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.15M NaCl,1mMEDTA,10%glycerol, pH 8.0 . |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTLEHHHHHH |
Source: E. coli.
MW :14.4kD.
Recombinant Human Zinc ring finger protein 1 is produced by our E.coli expression system and the target gene encoding Pro74-Thr178 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. E3 ubiquitin-protein ligase ZNRF1 contains one ring-type zinc finger, high expressed in the nervous system and developing brain, low expressed in testis and thymus. ZNRF1 mediates the ubiquitination of AKT1 and GLUL, so it plays a role in neuron cells differentiation. It also has a role in the establishment and maintenance of neuronal transmission and plasticity. ZNRF1 regulates Schwann cells differentiation by mediating ubiquitination of GLUL.
MW :14.4kD.
Recombinant Human Zinc ring finger protein 1 is produced by our E.coli expression system and the target gene encoding Pro74-Thr178 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. E3 ubiquitin-protein ligase ZNRF1 contains one ring-type zinc finger, high expressed in the nervous system and developing brain, low expressed in testis and thymus. ZNRF1 mediates the ubiquitination of AKT1 and GLUL, so it plays a role in neuron cells differentiation. It also has a role in the establishment and maintenance of neuronal transmission and plasticity. ZNRF1 regulates Schwann cells differentiation by mediating ubiquitination of GLUL.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endosome, Lysosome, Membrane, Cytoplasmic vesicle |
| Tissue Specificity: | Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus. |
| BioGrid: | 124371. 28 interactions. |
|
There are currently no product reviews
|

















.png)









