Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NACl,pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH |
Source: Human Cells.
MW :13.6kD.
Recombinant Human Placentin is produced by our Mammalian expression system and the target gene encoding Ala26-Thr139 is expressed with a 6His tag at the C-terminus. Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.
MW :13.6kD.
Recombinant Human Placentin is produced by our Mammalian expression system and the target gene encoding Ala26-Thr139 is expressed with a 6His tag at the C-terminus. Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. |
|
There are currently no product reviews
|














.png)









