Recombinant Human EDIL3/Del-1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEEVDHHHHHH |
Source: Human Cells.
MW :53.09kD.
Recombinant Human EDIL3/ is produced by our Mammalian expression system and the target gene encoding Val17-Glu480 is expressed with a 6His tag at the C-terminus. EGF-Like Repeat and Discoidin I-Like Domain-Containing Protein 3 (EDIL3) is a 52 kDa extracellular matrix protein that is expressed by endothelial tissues during embryonic vascular development. EDIL3 becomes quiescent at the time of birth, and is no longer expressed in normal adult tissues. EDIL3 has been found to be re-expressed in a number of human tumors as well as in ischemic muscles and ischemic brain tissue, which may play an important role in adult angiogenesis. EDIL3 promotes adherence and migration of endothelial cells, and acts as an endothelial cell survival agent through upregulation of Bcl-2 expression. EDIL3 has also been shown to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion. Human EDIL3 is synthesized as a precursor with a 16 amino acid signal sequence and a 464 amino acid mature chain.
MW :53.09kD.
Recombinant Human EDIL3/ is produced by our Mammalian expression system and the target gene encoding Val17-Glu480 is expressed with a 6His tag at the C-terminus. EGF-Like Repeat and Discoidin I-Like Domain-Containing Protein 3 (EDIL3) is a 52 kDa extracellular matrix protein that is expressed by endothelial tissues during embryonic vascular development. EDIL3 becomes quiescent at the time of birth, and is no longer expressed in normal adult tissues. EDIL3 has been found to be re-expressed in a number of human tumors as well as in ischemic muscles and ischemic brain tissue, which may play an important role in adult angiogenesis. EDIL3 promotes adherence and migration of endothelial cells, and acts as an endothelial cell survival agent through upregulation of Bcl-2 expression. EDIL3 has also been shown to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion. Human EDIL3 is synthesized as a precursor with a 16 amino acid signal sequence and a 464 amino acid mature chain.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 115394. 11 interactions. |
|
There are currently no product reviews
|













.png)








