Recombinant Human EIF4E-Binding Protein 2/EIF4EBP2 (N-6His
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI |
Source: E.coli.
MW :15.1kD.
Recombinant Human EIF4E-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile120 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) is a member of the Eukaryotic Translation Initiation Factor 4E Binding Protein Family. EIF4EBP2 regulates eIF4E activity by preventing its assembly into the eIF4F complex, mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. This regulation of is associated to cell proliferation, cell differentiation and viral infection. Phosphorylated EIF4EBP2 on serine and threonine residues in response to insulin, EGF and PDGF.
MW :15.1kD.
Recombinant Human EIF4E-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ile120 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) is a member of the Eukaryotic Translation Initiation Factor 4E Binding Protein Family. EIF4EBP2 regulates eIF4E activity by preventing its assembly into the eIF4F complex, mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase pathway. This regulation of is associated to cell proliferation, cell differentiation and viral infection. Phosphorylated EIF4EBP2 on serine and threonine residues in response to insulin, EGF and PDGF.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | Deamidated at Asn-99 and Asn-102 to aspartate (Asp) in brain. Deamidation promotes interaction with RPTOR, subsequent phosphorylation by mTORC1 and increased translation, leading to impair kinetics of excitatory synaptic transmission. Deamidation takes place during postnatal development, when the PI3K-Akt-mTOR signaling is reduced, suggesting it acts as a compensatory mechanism to promote translation despite attenuated PI3K-Akt-mTOR signaling in neuron development. Deamidation converts Asn residues into a mixture of Asp and isoaspartate; interactions with PCMT1 is required to prevent isoaspartate accumulation and convert isoaspartate to Asp. |
| BioGrid: | 108294. 12 interactions. |
|
There are currently no product reviews
|














.png)












