Recombinant Human ER Resident Protein 44/ERp44/TXNDC4 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris HCl,10%glycerol,PH7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDVDHHHHHH |
Source: Human Cells.
MW :44.2kD.
Recombinant Human ER resident protein 44 is produced by our Mammalian expression system and the target gene encoding Glu30-Asp402 is expressed with a 6His tag at the C-terminus. Endoplasmic reticulum resident protein 44 (TXNDC4) is is a 406 amino acid protein that contains one thioredoxin domain. TXNDC4 mediates thiol-dependent retention in the early secretory pathway and forms mixed disulfides with substrate proteins through its conserved CRFS motif.It can inhibit the calcium channel activity of ITPR1.It may have a role in the control of oxidative protein folding in the endoplasmic reticulum.
MW :44.2kD.
Recombinant Human ER resident protein 44 is produced by our Mammalian expression system and the target gene encoding Glu30-Asp402 is expressed with a 6His tag at the C-terminus. Endoplasmic reticulum resident protein 44 (TXNDC4) is is a 406 amino acid protein that contains one thioredoxin domain. TXNDC4 mediates thiol-dependent retention in the early secretory pathway and forms mixed disulfides with substrate proteins through its conserved CRFS motif.It can inhibit the calcium channel activity of ITPR1.It may have a role in the control of oxidative protein folding in the endoplasmic reticulum.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum lumen |
| BioGrid: | 116704. 81 interactions. |
|
There are currently no product reviews
|








![Anti-PLSCR1 Monoclonal Antibody (Clone:13A6 [TEC-23]) Anti-PLSCR1 Monoclonal Antibody (Clone:13A6 [TEC-23])](https://media.abeomics.com/images/30-2411/1.jpg)






.png)










