Recombinant Human Erythroid Membrane-Associated Protein/ERMAP (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVDHHHHHH |
Source: Human Cells.
MW :14.79kD.
Recombinant Human ERMAP is produced by our Mammalian expression system and the target gene encoding His30-Ala155 is expressed with a 6His tag at the C-terminus. Human Erythroid Membrane-Associated Protein (ERMAP) is a cell surface transmembrane protein that belongs to the immunoglobulin superfamily. It is hghly expressed in bone marrow and to a lower extent in leukocytes, thymus, lymph node and spleen. ERMAP contains 1 B30.2/SPRY domain and 1 Ig-like V-type (immunoglobulin-like) domain. It may serve as an erythroid cell receptor, possibly as a mediator of cell adhesion. ERMAP is responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene ERMAP.
MW :14.79kD.
Recombinant Human ERMAP is produced by our Mammalian expression system and the target gene encoding His30-Ala155 is expressed with a 6His tag at the C-terminus. Human Erythroid Membrane-Associated Protein (ERMAP) is a cell surface transmembrane protein that belongs to the immunoglobulin superfamily. It is hghly expressed in bone marrow and to a lower extent in leukocytes, thymus, lymph node and spleen. ERMAP contains 1 B30.2/SPRY domain and 1 Ig-like V-type (immunoglobulin-like) domain. It may serve as an erythroid cell receptor, possibly as a mediator of cell adhesion. ERMAP is responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene ERMAP.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Cytoplasm |
| Post transnational modification: | Glycosylated. |
| Tissue Specificity: | Expressed in erythroid-enriched bone marrow (at protein level). Highly expressed in bone marrow and to a lower extent in leukocytes, thymus, lymph node and spleen. |
| BioGrid: | 125328. 14 interactions. |
|
There are currently no product reviews
|

















.png)









