Recombinant Human Fatty Acid-Binding Protein 7/FABP7/B-FABP (N-6His)

Product code: 32-7120

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $376.00 

  • $579.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MGSSHHHHHHSSGLVPRGSHMVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Gene : FABP7
Gene ID : 2173
Uniprot ID : O15540
Source: E.coli.
MW :17.05kD.
Recombinant Human FABP7 is produced by our E.coli expression system and the target gene encoding Val2-Ala132 is expressed with a 6His tag at the N-terminus. Fatty Acid-Binding Protein 7 (FABP7) is a cytoplasm protein that belongs to the Fatty-acid Binding Protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP7 is predominately expressed in brain and neural tissues. FABP7 is involved in fatty acid uptake and intracellular transport and is important in brain development. FABP7 plays a critical role in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. FABP7 is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cytoplasm
Tissue Specificity: Expressed in brain and other neural tissues.
BioGrid: 108471. 10 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products