Recombinant Human Fc epsilon RII/CD23 (N-8His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHHHDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
Source: Human cells.
MW :32.1kD.
Recombinant Human Low Affinity Fc Epsilon RII is produced by our Mammalian expression system and the target gene encoding Asp48-Ser321 is expressed with a 8His tag at the N-terminus. Low affinity immunoglobulin epsilon Fc receptor(CD23) is a secreted and single-pass type II membrane protein which is also exists as a soluble excreted form. There are two forms of CD23: CD23a and CD23b. CD23a is present on follicular B cells, whereas CD23b requires IL-4 to be expressed on T-cells, monocytes, Langerhans cells, eosinophils, and macrophages. Unlike many of the antibody receptors, CD23/FCER2 is a C-type lectin. It is found on mature B cells, activated macrophages, eosinophils, follicular dendritic cells, and platelets. In flow cytometry, CD23/FCER2 is helpful in the differentiation of chronic lymphocytic leukemia (CD23-positive) from mantle cell leukemia (CD23-negative). CD23/FCER2 can also be demonstrated in germinal centre B-cells using immunohistochemistry, but it is not present in the resting cells of the surrounding mantle zone. CD23/FCER2 has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specificantigen).
MW :32.1kD.
Recombinant Human Low Affinity Fc Epsilon RII is produced by our Mammalian expression system and the target gene encoding Asp48-Ser321 is expressed with a 8His tag at the N-terminus. Low affinity immunoglobulin epsilon Fc receptor(CD23) is a secreted and single-pass type II membrane protein which is also exists as a soluble excreted form. There are two forms of CD23: CD23a and CD23b. CD23a is present on follicular B cells, whereas CD23b requires IL-4 to be expressed on T-cells, monocytes, Langerhans cells, eosinophils, and macrophages. Unlike many of the antibody receptors, CD23/FCER2 is a C-type lectin. It is found on mature B cells, activated macrophages, eosinophils, follicular dendritic cells, and platelets. In flow cytometry, CD23/FCER2 is helpful in the differentiation of chronic lymphocytic leukemia (CD23-positive) from mantle cell leukemia (CD23-negative). CD23/FCER2 can also be demonstrated in germinal centre B-cells using immunohistochemistry, but it is not present in the resting cells of the surrounding mantle zone. CD23/FCER2 has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specificantigen).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Cell membrane, Secreted |
| Post transnational modification: | The secreted form sCD23 is produced by ADAM10-mediated ectodomain shedding. |
| BioGrid: | 108502. 4 interactions. |
|
There are currently no product reviews
|



















.png)











