Recombinant Human Fc Receptor-Like Protein 1/FCRL1/CD307a (C-6His)

Product code: 32-7540

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $352.00 

  • $487.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH
Gene : FCRL1
Gene ID : 115350
Uniprot ID : Q96LA6
Source: Human Cells.
MW :32.24kD.
Recombinant Human FcRL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asn303 is expressed with a 6His tag at the C-terminus. Fc Receptor-Like Protein 1 (FCRL1) is a single-pass type I membrane protein that may function as an activating coreceptor in B cells. FCRL1 is primarily expressed in secondary lymphoid tissues by mature subsets of B cells. It can be detected in the spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. It is specifically expressed by mature B lineage cells with higher expression at the protein level in naive B cells compared to memory B cells. FCRL1 contains three extracellular C2-like immunoglobulin domains, a transmembrane domain, and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs and may play a role in the regulation of cancer cell growth.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cell membrane
Post transnational modification: Phosphorylated on tyrosines upon activation.
Tissue Specificity: Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level).
BioGrid: 125427. 1 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products