Recombinant Human Follicle-Stimulating Hormone a/ beta Dimer
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
| Gene : | CGA |
| Gene ID : | 1081 |
| Uniprot ID : | P01215&P01225 |
Source: Human Cells.
MW :10.2&12.5kD.
Recombinant Human Follicle-Stimulating Hormone is produced by our Mammalian expression system and the target gene encoding Ala25-Ser116&Asn19-Glu129 is expressed. Human Follicle-stimulating hormone (FSH) is a member of glycoprotein hormones subunit beta family, whichalso includes LH, chorionic gonadotropin (CG) and thyroid-stimulating hormone (TSH). FSH and its familymembers are heterodimers consisting of non-covalently linked a- and beta-subunits. They share an identical asubunit, and beta-subunits vary. FSH has a unique beta-subunit (FSH beta), which confers its specific biologic activityand is responsible for interaction with the FSH-receptor which belongs to a subfamily of GPCRs calledleucine-rich-repeat-containing GPCRs (LGRs). FSH is secreted from the pituitary gland and regulatesreproduction in mammals. FSH stimulates sertoli cell proliferation in testes and supports spermatogenesis inmales, and induces the maturation of ovarian follicles in females.
MW :10.2&12.5kD.
Recombinant Human Follicle-Stimulating Hormone is produced by our Mammalian expression system and the target gene encoding Ala25-Ser116&Asn19-Glu129 is expressed. Human Follicle-stimulating hormone (FSH) is a member of glycoprotein hormones subunit beta family, whichalso includes LH, chorionic gonadotropin (CG) and thyroid-stimulating hormone (TSH). FSH and its familymembers are heterodimers consisting of non-covalently linked a- and beta-subunits. They share an identical asubunit, and beta-subunits vary. FSH has a unique beta-subunit (FSH beta), which confers its specific biologic activityand is responsible for interaction with the FSH-receptor which belongs to a subfamily of GPCRs calledleucine-rich-repeat-containing GPCRs (LGRs). FSH is secreted from the pituitary gland and regulatesreproduction in mammals. FSH stimulates sertoli cell proliferation in testes and supports spermatogenesis inmales, and induces the maturation of ovarian follicles in females.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 107507. 5 interactions. |
|
There are currently no product reviews
|











.png)








