Recombinant Human Galectin-14/LGALS14 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tri,100mM NaCl,1mM DTT,20% glycerol,pH8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDVDHHHHHH |
Source: Human Cells.
MW :17.1kD.
Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind beta-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
MW :17.1kD.
Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind beta-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| Tissue Specificity: | Highly expressed in placenta. |
| BioGrid: | 121221. 15 interactions. |
|
There are currently no product reviews
|



















.png)








