Recombinant Human Galectin-14/LGALS14 (C-6His)

Product code: 32-7657

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $420.00 

  • $699.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM Tri,100mM NaCl,1mM DTT,20% glycerol,pH8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDVDHHHHHH
Gene : LGALS14
Gene ID : 56891
Uniprot ID : Q8TCE9
Source: Human Cells.
MW :17.1kD.
Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind beta-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Nucleus
Tissue Specificity: Highly expressed in placenta.
BioGrid: 121221. 15 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products