Recombinant Human HDHD2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 50mM NaCl, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL |
Source: E.coli.
MW :30.7kD.
Recombinant Human HDHD2 is produced by our E.coli expression system and the target gene encoding Met1-Leu259 is expressed with a 6His tag at the N-terminus. Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 22 (HDHD2) is a member of the HAD-like hydrolase superfamily. HDHD2 includes L-2-Haloacid Dehalogenase, Epoxide Hydrolases and Phosphatases. There are two active sites in HDHD2 - an L-2-Haloacid Dehalogenase and a Carboxylate group. The L-2-Haloacid Dehalogenase active site catalyzes the hydrolytic dehalogenation of D- and L-2-Haloalkanoic Acids, producing L- and D-2-Hydroxyalkanoic Acids.
MW :30.7kD.
Recombinant Human HDHD2 is produced by our E.coli expression system and the target gene encoding Met1-Leu259 is expressed with a 6His tag at the N-terminus. Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 22 (HDHD2) is a member of the HAD-like hydrolase superfamily. HDHD2 includes L-2-Haloacid Dehalogenase, Epoxide Hydrolases and Phosphatases. There are two active sites in HDHD2 - an L-2-Haloacid Dehalogenase and a Carboxylate group. The L-2-Haloacid Dehalogenase active site catalyzes the hydrolytic dehalogenation of D- and L-2-Haloalkanoic Acids, producing L- and D-2-Hydroxyalkanoic Acids.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 123859. 8 interactions. |
|
There are currently no product reviews
|










.png)











