Recombinant Human Heat Shock Protein beta-8//HSPB8 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCTLEHHHHHH |
Source: E. coli.
MW :22.7kD.
Recombinant Human Heat shock protein beta-8 is produced by our E.coli expression system and the target gene encoding Met1-Thr196 is expressed with a 6His tag at the C-terminus. Heat shock protein beta-8 (HSPB8) belongs to the small heat shock protein (HSP20) family. This protein can be inducted by 17-beta-estradiol, and is predominantly expressed in skeletal muscle and heat, mainly located in the cytoplasm and nucleus. HSPB8 usually exists in monomer, it can interact with HSPB1 and DNAJB6. HSPB8 displays temperature-dependent chaperone activity,appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.
MW :22.7kD.
Recombinant Human Heat shock protein beta-8 is produced by our E.coli expression system and the target gene encoding Met1-Thr196 is expressed with a 6His tag at the C-terminus. Heat shock protein beta-8 (HSPB8) belongs to the small heat shock protein (HSP20) family. This protein can be inducted by 17-beta-estradiol, and is predominantly expressed in skeletal muscle and heat, mainly located in the cytoplasm and nucleus. HSPB8 usually exists in monomer, it can interact with HSPB1 and DNAJB6. HSPB8 displays temperature-dependent chaperone activity,appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| Tissue Specificity: | Predominantly expressed in skeletal muscle and heart. |
| BioGrid: | 117689. 38 interactions. |
|
There are currently no product reviews
|












.png)










