Recombinant Human IL-15 Receptor Subunit a/IL-15RA/CD215 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :45.5kD.
Recombinant Human Interleukin-15 receptor alpha is produced by our Mammalian expression system and the target gene encoding Ile31-Thr205 is expressed with a Fc tag at the C-terminus. Interleukin 15 Receptor alpha (IL-15R alpha ) is a transmembrane glycoprotein that plays a pleiotropic role in immune development and function, including the positive maintenance of lymphocyte homeostasis. IL-15R alpha chain can bind soluble IL-15 and “transpresent” cytokine to the cells, allowing them to respond to IL-15. Soluble IL-15R alpha can function as a specific high-affinity IL-15 antagonist. The soluble IL-15/IL-15R alpha complexes exhibit a strong agonistic activity which is mediated through membrane-bound IL-15 receptor beta and gamma heterodimers and enables signaling to cells.
MW :45.5kD.
Recombinant Human Interleukin-15 receptor alpha is produced by our Mammalian expression system and the target gene encoding Ile31-Thr205 is expressed with a Fc tag at the C-terminus. Interleukin 15 Receptor alpha (IL-15R alpha ) is a transmembrane glycoprotein that plays a pleiotropic role in immune development and function, including the positive maintenance of lymphocyte homeostasis. IL-15R alpha chain can bind soluble IL-15 and “transpresent” cytokine to the cells, allowing them to respond to IL-15. Soluble IL-15R alpha can function as a specific high-affinity IL-15 antagonist. The soluble IL-15/IL-15R alpha complexes exhibit a strong agonistic activity which is mediated through membrane-bound IL-15 receptor beta and gamma heterodimers and enables signaling to cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-glycosylated and O-glycosylated. |
| Tissue Specificity: | Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures. |
| BioGrid: | 109814. 8 interactions. |
|
There are currently no product reviews
|
















.png)











