Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1 (4-70)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 300mM NaAc, pH 6.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
MW :7.3kD.
Recombinant Human Insulin-like Growth Factor I is produced by our E.coli expression system and the target gene encoding Thr52-Ala118 is expressed. Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.05 ng/µg (0.5 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 109700. 13 interactions. |
|
There are currently no product reviews
|

















.png)








