Recombinant Human Insulin-Like Growth Factor II/IGF2(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 5mM Hac, pH ~3.0. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MFPAMPLSSLFVNAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
MW :8.91kD.
Recombinant Human Insulin-Like Growth Factor II is produced by our E.coli expression system and the target gene encoding Ala25-Glu91 is expressed. Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | Proteolytically processed by PCSK4, proIGF2 is cleaved at Arg-128 and Arg-92 to generate big-IGF2 and mature IGF2. |
Tissue Specificity: | Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas. |
BioGrid: | 109702. 29 interactions. |
There are currently no product reviews
|