Recombinant Human Interferon Lambda-2/IL-28A(C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVHHHHHH |
Source: Human cells.
MW :20.6kD.
Recombinant Human Interferon Lambda-2 is produced by our Mammalian expression system and the target gene encoding Val26-Val200 is expressed with a 6His tag at the C-terminus. IL-28A (Interferon-lambda2? IFN-lambda2), IL-28B/IFN-lambda3, and IL-29/IFN-lambda1 are type III interferons which are distantly related to IL-10 family and type I IFN family cytokines. Mature human IL-28A is an approximately 22-25 kDa protein that shares 66% amino acid (aa) sequence identity with mouse and rat IL-28A and shows cross-species activity. It shares 96% and 70% aa sequence identity with human IL-28B and IL-29, respectively. IL-28A promotes the Th1 polarization of dendritic cells in the airway and inhibits Th2 and Th17 mediated inflammation. IL-28A additionally exhibits anti-tumor activity, in part by enhancing IL-12 dependent anti-tumor CTL responses in vivo. In contrast, it is up-regulated in invasive bladder cancer where it promotes tumor cell migration.
MW :20.6kD.
Recombinant Human Interferon Lambda-2 is produced by our Mammalian expression system and the target gene encoding Val26-Val200 is expressed with a 6His tag at the C-terminus. IL-28A (Interferon-lambda2? IFN-lambda2), IL-28B/IFN-lambda3, and IL-29/IFN-lambda1 are type III interferons which are distantly related to IL-10 family and type I IFN family cytokines. Mature human IL-28A is an approximately 22-25 kDa protein that shares 66% amino acid (aa) sequence identity with mouse and rat IL-28A and shows cross-species activity. It shares 96% and 70% aa sequence identity with human IL-28B and IL-29, respectively. IL-28A promotes the Th1 polarization of dendritic cells in the airway and inhibits Th2 and Th17 mediated inflammation. IL-28A additionally exhibits anti-tumor activity, in part by enhancing IL-12 dependent anti-tumor CTL responses in vivo. In contrast, it is up-regulated in invasive bladder cancer where it promotes tumor cell migration.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 129394. 1 interactions. |
|
There are currently no product reviews
|











.png)











