Recombinant Human Interleukin-17B/IL-17B (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIFVDHHHHHH |
Source: Human Cells.
MW :19.2kD.
Recombinant Human Interleukin-17B is produced by our Mammalian expression system and the target gene encoding Gln21-Phe180 is expressed with a 6His tag at the C-terminus. Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses and inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E and IL-17F. The six IL-17 cytokines are highly conserved at C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine and chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells.
MW :19.2kD.
Recombinant Human Interleukin-17B is produced by our Mammalian expression system and the target gene encoding Gln21-Phe180 is expressed with a 6His tag at the C-terminus. Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses and inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E and IL-17F. The six IL-17 cytokines are highly conserved at C terminus, and contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine and chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) and induces the production of inflammatory cytokines and the infiltration of inflammatory immune cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary. |
| BioGrid: | 118065. 25 interactions. |
|
There are currently no product reviews
|









.png)








