Recombinant Human Interleukin-17F/IL-17F (Human Cells)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ |
Source: Human Cells.
MW :14.9kD.
Recombinant Human Interleukin-17F is produced by our Mammalian expression system and the target gene encoding Arg31-Gln163 is expressed. Interleukin-17F (IL-17F) exists in a disulfide-linked heterodimer that belongs to the IL-17 family. IL-17F is expressed in activated, but not resting, CD4+ T-cells and activated monocytes. IL-17F has been shown to stimulate the production of several other cytokines, including IL-6, IL-8, and granulocyte colony-stimulating factor. IL-17F can regulate cartilage matrix turnover and stimulates PBMC and T-cell proliferation. IL-17F is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. Defects in IL-17F are the cause of familial candidiasis type 6 (CANDF6).
MW :14.9kD.
Recombinant Human Interleukin-17F is produced by our Mammalian expression system and the target gene encoding Arg31-Gln163 is expressed. Interleukin-17F (IL-17F) exists in a disulfide-linked heterodimer that belongs to the IL-17 family. IL-17F is expressed in activated, but not resting, CD4+ T-cells and activated monocytes. IL-17F has been shown to stimulate the production of several other cytokines, including IL-6, IL-8, and granulocyte colony-stimulating factor. IL-17F can regulate cartilage matrix turnover and stimulates PBMC and T-cell proliferation. IL-17F is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. Defects in IL-17F are the cause of familial candidiasis type 6 (CANDF6).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed in activated, but not resting, CD4+ T-cells and activated monocytes. |
| BioGrid: | 125201. 31 interactions. |
|
There are currently no product reviews
|












.png)











